SCOPe 2.04: Domain d4emqb_: 4emq B:

Lineage for d4emqb_ (4emq B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (18 species)
   not a true protein

7. Species Echinophyllia sp. [TaxId:301887] [188534] (12 PDB entries)

8. Domain d4emqb_: 4emq B: [220659]
   automated match to d1xssb_
   complexed with 1pe, epe, peg; mutant

Details for d4emqb_

PDB Entry: 4emq, 1.95 Å

PDB Description: Crystal structure of a single mutant of Dronpa, the green-on-state PDM1-4

PDB Compounds: (B:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d4emqb_:

Sequence; same for both SEQRES and ATOM records:

>d4emqb_ d.22.1.0 (B:) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
vnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
vqlpdyhfvdhhieikshdkdysnvnlhehaeahse

Timeline for d4emqb_:

• d4emqb_ first appeared in SCOPe 2.03
  
• d4emqb_ appears in SCOPe 2.05
  
• d4emqb_ appears in the current release, SCOPe 2.08