| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries) |
| Domain d4emqb_: 4emq B: [220659] automated match to d1xssb_ complexed with 1pe, epe, peg; mutant |
PDB Entry: 4emq (more details), 1.95 Å
SCOPe Domain Sequences for d4emqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4emqb_ d.22.1.0 (B:) automated matches {Echinophyllia sp. [TaxId: 301887]}
vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfc
ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
vnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
vqlpdyhfvdhhieikshdkdysnvnlhehaeahse
Timeline for d4emqb_: