Lineage for d4emla_ (4eml A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100595Species Synechocystis sp. [TaxId:1111708] [197025] (3 PDB entries)
  8. 2100596Domain d4emla_: 4eml A: [220652]
    automated match to d4i4za_
    complexed with bct, cl, gol, mpd, so4

Details for d4emla_

PDB Entry: 4eml (more details), 2.04 Å

PDB Description: Synechocystis sp. PCC 6803 1,4-dihydroxy-2-naphthoyl-coenzyme A synthase (MenB) in complex with bicarbonate
PDB Compounds: (A:) naphthoate synthase

SCOPe Domain Sequences for d4emla_:

Sequence, based on SEQRES records: (download)

>d4emla_ c.14.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdwhiakhyddilyykaggiakivinrphkrnafrpqtvfelydafcnarednrigvvll
tgagphsdgkyafcsggdqsvrgeggyiddqgtprlnvldlqrlirsmpkvvialvagya
iggghvlhlvcdltiaadnaifgqtgpkvgsfdggfgssylarivgqkkareiwylcrqy
saqeaermgmvntvvpvdrleeegiqwakeilsksplairclkaafnadcdgqaglqela
gnatllyymteegsegkqaflekrppdfsqypwlp

Sequence, based on observed residues (ATOM records): (download)

>d4emla_ c.14.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdwhiakhyddilyykaggiakivinrphkrnafrpqtvfelydafcnarednrigvvll
tgagphsdgkyafcsggdqsrlnvldlqrlirsmpkvvialvagyaiggghvlhlvcdlt
iaadnaifgqtgpkvgsfdggfgssylarivgqkkareiwylcrqysaqeaermgmvntv
vpvdrleeegiqwakeilsksplairclkaafnadcdgqaglqelagnatllyymteegs
egkqaflekrppdfsqypwlp

SCOPe Domain Coordinates for d4emla_:

Click to download the PDB-style file with coordinates for d4emla_.
(The format of our PDB-style files is described here.)

Timeline for d4emla_: