SCOPe 2.05: Domain d4embb_: 4emb B:

Lineage for d4embb_ (4emb B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.0: automated matches [196988] (1 protein)
   not a true family

6. Protein automated matches [196989] (8 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226360] (1 PDB entry)

8. Domain d4embb_: 4emb B: [220648]
   automated match to d2hhja_
   complexed with cl, edo

Details for d4embb_

PDB Entry: 4emb, 2.3 Å

PDB Description: Crystal structure of a phosphoglycerate mutase gpmA from Borrelia burgdorferi B31

PDB Compounds: (B:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d4embb_:

Sequence; same for both SEQRES and ATOM records:

>d4embb_ c.60.1.0 (B:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
fmyklvlvrhgesewnkenlftgwtdvklsdkgideaveaglllkqegysfdiafsslls
randtlniilrelgqsyisvkktwrlnerhygalqglnksetaakygedkvliwrrsydv
ppmsldesddrhpikdprykhipkrelpsteclkdtvarvipywtdeiakevlegkkviv
aahgnslralvkyfdnlseedvlklniptgiplvyeldkdlnpikhyylgdeskikkame
s

Timeline for d4embb_:

• d4embb_ first appeared in SCOPe 2.03
  
• d4embb_ appears in SCOPe 2.04
  
• d4embb_ is called d4embb1 in SCOPe 2.06
  
• d4embb_ appears in the current release, SCOPe 2.08, called d4embb1