Lineage for d4embb1 (4emb B:6-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891217Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2891218Protein automated matches [196989] (16 species)
    not a true protein
  7. 2891256Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226360] (1 PDB entry)
  8. 2891258Domain d4embb1: 4emb B:6-245 [220648]
    Other proteins in same PDB: d4emba2, d4embb2, d4embc2, d4embd2
    automated match to d2hhja_
    complexed with cl, edo

Details for d4embb1

PDB Entry: 4emb (more details), 2.3 Å

PDB Description: Crystal structure of a phosphoglycerate mutase gpmA from Borrelia burgdorferi B31
PDB Compounds: (B:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d4embb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4embb1 c.60.1.0 (B:6-245) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
myklvlvrhgesewnkenlftgwtdvklsdkgideaveaglllkqegysfdiafssllsr
andtlniilrelgqsyisvkktwrlnerhygalqglnksetaakygedkvliwrrsydvp
pmsldesddrhpikdprykhipkrelpsteclkdtvarvipywtdeiakevlegkkviva
ahgnslralvkyfdnlseedvlklniptgiplvyeldkdlnpikhyylgdeskikkames

SCOPe Domain Coordinates for d4embb1:

Click to download the PDB-style file with coordinates for d4embb1.
(The format of our PDB-style files is described here.)

Timeline for d4embb1: