![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
![]() | Protein automated matches [196989] (16 species) not a true protein |
![]() | Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226360] (1 PDB entry) |
![]() | Domain d4embb1: 4emb B:6-245 [220648] Other proteins in same PDB: d4emba2, d4embb2, d4embc2, d4embd2 automated match to d2hhja_ complexed with cl, edo |
PDB Entry: 4emb (more details), 2.3 Å
SCOPe Domain Sequences for d4embb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4embb1 c.60.1.0 (B:6-245) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} myklvlvrhgesewnkenlftgwtdvklsdkgideaveaglllkqegysfdiafssllsr andtlniilrelgqsyisvkktwrlnerhygalqglnksetaakygedkvliwrrsydvp pmsldesddrhpikdprykhipkrelpsteclkdtvarvipywtdeiakevlegkkviva ahgnslralvkyfdnlseedvlklniptgiplvyeldkdlnpikhyylgdeskikkames
Timeline for d4embb1: