Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries) |
Domain d4elxd_: 4elx D: [220639] automated match to d4elwa_ complexed with cl, edo, gol, peg, po4 |
PDB Entry: 4elx (more details), 2.19 Å
SCOPe Domain Sequences for d4elxd_:
Sequence, based on SEQRES records: (download)
>d4elxd_ c.14.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]} pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada ryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvv amvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkarei wflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgq aglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
>d4elxd_ c.14.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]} pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada ryddnigviiltgagdkafcsggdqlnvldfqrqirtcpkpvvamvagysiggghvlhmm cdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldmgl vntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymt eegqegrnafnqkrqpdfskfkrnp
Timeline for d4elxd_: