Lineage for d4elxc_ (4elx C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100099Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries)
  8. 2100114Domain d4elxc_: 4elx C: [220638]
    automated match to d4elwa_
    complexed with cl, edo, gol, peg, po4

Details for d4elxc_

PDB Entry: 4elx (more details), 2.19 Å

PDB Description: Structure of apo E.coli. 1,4-dihydroxy-2- naphthoyl CoA synthases with Cl
PDB Compounds: (C:) 1,4-Dihydroxy-2-naphthoyl-CoA synthase

SCOPe Domain Sequences for d4elxc_:

Sequence, based on SEQRES records: (download)

>d4elxc_ c.14.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
ryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvv
amvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkarei
wflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgq
aglqelagnatmlfymt

Sequence, based on observed residues (ATOM records): (download)

>d4elxc_ c.14.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada
ryddnigviiltgagdkafcsggdvhhlnvldfqrqirtcpkpvvamvagysiggghvlh
mmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldm
glvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfy
mt

SCOPe Domain Coordinates for d4elxc_:

Click to download the PDB-style file with coordinates for d4elxc_.
(The format of our PDB-style files is described here.)

Timeline for d4elxc_: