Lineage for d4elqb_ (4elq B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523643Species Thermus thermophilus HB8 [TaxId:300852] [226637] (8 PDB entries)
  8. 2523657Domain d4elqb_: 4elq B: [220627]
    automated match to d1xvya_
    complexed with co3

Details for d4elqb_

PDB Entry: 4elq (more details), 1.89 Å

PDB Description: Ferric binding protein with carbonate
PDB Compounds: (B:) Iron ABC transporter, periplasmic iron-binding protein

SCOPe Domain Sequences for d4elqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elqb_ c.94.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
sptltiysgrgqslveplvkqfeaetgirvqvrystdaqilaalqeegsrspadlfwant
agalgqasakgllrplgetllekpiafvpasrtwvpvtvrlrvlaynpdrikaeelpesl
ldlprfarekglvgrvgwtptyssfqdmvagmialygeektrewllamkalapkaypsnp
amldairagevdlgstnhyyvvrfrragyrlgmhhfrdgdagnlalvtgagllktsknla
aatrfltyllspqaqqyfvgnigeyplvkgvaldpnllpleealakspkldleklpldra
lrllretgvl

SCOPe Domain Coordinates for d4elqb_:

Click to download the PDB-style file with coordinates for d4elqb_.
(The format of our PDB-style files is described here.)

Timeline for d4elqb_: