Lineage for d4elpd_ (4elp D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1881005Species Thermus thermophilus HB8 [TaxId:300852] [226637] (8 PDB entries)
  8. 1881027Domain d4elpd_: 4elp D: [220625]
    automated match to d1xvya_
    complexed with co3

Details for d4elpd_

PDB Entry: 4elp (more details), 2.07 Å

PDB Description: Ferric binding protein in apo form 2
PDB Compounds: (D:) Iron ABC transporter, periplasmic iron-binding protein

SCOPe Domain Sequences for d4elpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elpd_ c.94.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tltiysgrgqslveplvkqfeaetgirvqvrystdaqilaalqeegsrspadlfwantag
algqasakgllrplgetllekpiafvpasrtwvpvtvrlrvlaynpdrikaeelpeslld
lprfarekglvgrvgwtptyssfqdmvagmialygeektrewllamkalapkaypsnpam
ldairagevdlgstnhyyvvrfrragyrlgmhhfrdgdagnlalvtgagllktsknlaaa
trfltyllspqaqqyfvgnigeyplvkgvaldpnllpleealakspkldleklpldralr
llretgvl

SCOPe Domain Coordinates for d4elpd_:

Click to download the PDB-style file with coordinates for d4elpd_.
(The format of our PDB-style files is described here.)

Timeline for d4elpd_: