SCOPe 2.03: Domain d4elof_: 4elo F:

Lineage for d4elof_ (4elo F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [226637] (4 PDB entries)

8. Domain d4elof_: 4elo F: [220621]
   automated match to d1xvya_

Details for d4elof_

PDB Entry: 4elo, 1.91 Å

PDB Description: Ferric binding protein in apo form 1

PDB Compounds: (F:) Iron ABC transporter, periplasmic iron-binding protein

SCOPe Domain Sequences for d4elof_:

Sequence; same for both SEQRES and ATOM records:

>d4elof_ c.94.1.0 (F:) automated matches {Thermus thermophilus [TaxId: 300852]}
tltiysgrgqslveplvkqfeaetgirvqvrystdaqilaalqeegsrspadlfwantag
algqasakgllrplgetllekpiafvpasrtwvpvtvrlrvlaynpdrikaeelpeslld
lprfarekglvgrvgwtptyssfqdmvagmialygeektrewllamkalapkaypsnpam
ldairagevdlgstnhyyvvrfrragyrlgmhhfrdgdagnlalvtgagllktsknlaaa
trfltyllspqaqqyfvgnigeyplvkgvaldpnllpleealakspkldleklpldralr
llretgvl

Timeline for d4elof_:

• d4elof_ is new in SCOPe 2.03-stable
  
• d4elof_ appears in SCOPe 2.04
  
• d4elof_ appears in the current release, SCOPe 2.08