![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
![]() | Domain d4elkd2: 4elk D:117-244 [220615] Other proteins in same PDB: d4elka1, d4elkb1, d4elkc1, d4elkd1 automated match to d1ktke2 complexed with act, fmt, mli |
PDB Entry: 4elk (more details), 2.1 Å
SCOPe Domain Sequences for d4elkd2:
Sequence, based on SEQRES records: (download)
>d4elkd2 b.1.1.2 (D:117-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
>d4elkd2 b.1.1.2 (D:117-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsndewtqdrakpvtqivs aeawgra
Timeline for d4elkd2: