Lineage for d4elkc2 (4elk C:116-207)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1294969Domain d4elkc2: 4elk C:116-207 [220613]
    Other proteins in same PDB: d4elka1, d4elkb1, d4elkc1, d4elkd1
    automated match to d2f54d2
    complexed with act, fmt, mli

Details for d4elkc2

PDB Entry: 4elk (more details), 2.1 Å

PDB Description: Crystal structure of the Hy19.3 type II NKT TCR
PDB Compounds: (C:) Hy19.3 TCR alpha chain (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4elkc2:

Sequence, based on SEQRES records: (download)

>d4elkc2 b.1.1.2 (C:116-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspes

Sequence, based on observed residues (ATOM records): (download)

>d4elkc2 b.1.1.2 (C:116-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqsdsdvyitdkcvldmrsmdfksnsa
vawsnkdfacanafnnsiipedtffpspes

SCOPe Domain Coordinates for d4elkc2:

Click to download the PDB-style file with coordinates for d4elkc2.
(The format of our PDB-style files is described here.)

Timeline for d4elkc2: