Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interferon-gamma receptor alpha chain [49293] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries) |
Domain d1fg9c2: 1fg9 C:110-224 [22061] Other proteins in same PDB: d1fg9a_, d1fg9b_ |
PDB Entry: 1fg9 (more details), 2.9 Å
SCOPe Domain Sequences for d1fg9c2:
Sequence, based on SEQRES records: (download)
>d1fg9c2 b.1.2.1 (C:110-224) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifns
>d1fg9c2 b.1.2.1 (C:110-224) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} igppkldirkeekqimidifhpsvfvngdeqedpettcyirvynvyvrmngseiqykilt qkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitifns
Timeline for d1fg9c2: