Lineage for d4eksa1 (4eks A:1-164)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2532819Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2532825Protein Phage T4 lysozyme [53982] (1 species)
  7. 2532826Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2532892Domain d4eksa1: 4eks A:1-164 [220601]
    Other proteins in same PDB: d4eksa2, d4eksb2
    automated match to d3dkex_
    complexed with 0r1, act, bme, hed, so4

Details for d4eksa1

PDB Entry: 4eks (more details), 1.64 Å

PDB Description: T4 Lysozyme L99A/M102H with Isoxazole Bound
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d4eksa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eksa1 d.2.1.3 (A:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvtgvagftnvlrm
lqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d4eksa1:

Click to download the PDB-style file with coordinates for d4eksa1.
(The format of our PDB-style files is described here.)

Timeline for d4eksa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eksa2