Lineage for d4ekra1 (4ekr A:1-164)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2925652Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2925658Protein Phage T4 lysozyme [53982] (1 species)
  7. 2925659Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2925692Domain d4ekra1: 4ekr A:1-164 [220599]
    Other proteins in same PDB: d4ekra2, d4ekrb2
    automated match to d3dkex_
    complexed with 0r0, act, bme, hed, so4

Details for d4ekra1

PDB Entry: 4ekr (more details), 1.49 Å

PDB Description: T4 Lysozyme L99A/M102H with 2-Cyanophenol Bound
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d4ekra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ekra1 d.2.1.3 (A:1-164) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvtgvagftnvlrm
lqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d4ekra1:

Click to download the PDB-style file with coordinates for d4ekra1.
(The format of our PDB-style files is described here.)

Timeline for d4ekra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ekra2