Lineage for d4ekpa_ (4ekp A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1398168Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1398174Protein Phage T4 lysozyme [53982] (1 species)
  7. 1398175Species Bacteriophage T4 [TaxId:10665] [53983] (542 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1398247Domain d4ekpa_: 4ekp A: [220595]
    automated match to d3dkex_
    complexed with act, bme, hed, nbz, so4

Details for d4ekpa_

PDB Entry: 4ekp (more details), 1.64 Å

PDB Description: T4 Lysozyme L99A/M102H with Nitrobenzene Bound
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d4ekpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ekpa_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
pttenlyfqgsmnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldka
igrncngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainhvfqmgvt
gvagftnvlrmlqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d4ekpa_:

Click to download the PDB-style file with coordinates for d4ekpa_.
(The format of our PDB-style files is described here.)

Timeline for d4ekpa_: