| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
| Protein automated matches [226938] (26 species) not a true protein |
| Species Methanocaldococcus jannaschii [TaxId:243232] [226368] (1 PDB entry) |
| Domain d4eknb2: 4ekn B:149-304 [220594] automated match to d1pg5a2 complexed with gol, k, so4 |
PDB Entry: 4ekn (more details), 2.5 Å
SCOPe Domain Sequences for d4eknb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eknb2 c.78.1.0 (B:149-304) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
idgikiafvgdlkygrtvhslvyalslfenvemyfvspkelrlpkdiiedlkaknikfye
keslddldddidvlyvtriqkerfpdpneyekvkgsykikreyvegkkfiimhplprvde
idydvddlpqakyfkqsfygipvrmailkkliedne
Timeline for d4eknb2: