Lineage for d4eknb1 (4ekn B:1-148)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907005Species Methanocaldococcus jannaschii [TaxId:243232] [226368] (1 PDB entry)
  8. 2907006Domain d4eknb1: 4ekn B:1-148 [220593]
    automated match to d1pg5a1
    complexed with gol, k, so4

Details for d4eknb1

PDB Entry: 4ekn (more details), 2.5 Å

PDB Description: Structure of the catalytic chain of Methanococcus jannaschii Aspartate Transcarbamoylase in a hexagonal crystal form
PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4eknb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eknb1 c.78.1.0 (B:1-148) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkhlismkdigkeeileildearkmeellntkrplkllegkilatvfyepstrtrlsfet
amkrlggevitmtdlksssvakgeslidtirvisgyadiivlrhpsegaarlaseysqvp
iinagdgsnqhptqtlldlytimreigr

SCOPe Domain Coordinates for d4eknb1:

Click to download the PDB-style file with coordinates for d4eknb1.
(The format of our PDB-style files is described here.)

Timeline for d4eknb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eknb2