Lineage for d4ekdb1 (4ekd B:72-200)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719792Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2719842Protein automated matches [190756] (2 species)
    not a true protein
  7. 2719843Species Human (Homo sapiens) [TaxId:9606] [187954] (3 PDB entries)
  8. 2719846Domain d4ekdb1: 4ekd B:72-200 [220592]
    Other proteins in same PDB: d4ekdb2
    automated match to d2odeb_
    complexed with alf, cl, co, gdp, mes, mg

Details for d4ekdb1

PDB Entry: 4ekd (more details), 2.71 Å

PDB Description: structure of human regulator of g protein signaling 2 (rgs2) in complex with murine galpha-q(r183c)
PDB Compounds: (B:) Regulator of G-protein signaling 2

SCOPe Domain Sequences for d4ekdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ekdb1 a.91.1.1 (B:72-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspqklssk
arkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsyprfle
sefyqdlck

SCOPe Domain Coordinates for d4ekdb1:

Click to download the PDB-style file with coordinates for d4ekdb1.
(The format of our PDB-style files is described here.)

Timeline for d4ekdb1: