SCOP 1.69: Domain d1jrhi_: 1jrh I:

Lineage for d1jrhi_ (1jrh I:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (24 proteins)

6. Protein Interferon-gamma receptor alpha chain [49293] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)

8. Domain d1jrhi_: 1jrh I: [22059]
   Other proteins in same PDB: d1jrhh1, d1jrhh2, d1jrhl1, d1jrhl2
   N-terminal domain

Details for d1jrhi_

PDB Entry: 1jrh, 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhi_:

Sequence; same for both SEQRES and ATOM records:

>d1jrhi_ b.1.2.1 (I:) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
svptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycni
sdhvgdpsnslwvrvkarvgqkesayakseefavs

Timeline for d1jrhi_:

• d1jrhi_ first appeared (with stable ids) in SCOP 1.55
  
• d1jrhi_ appears in SCOP 1.67
  
• d1jrhi_ appears in SCOP 1.71
  
• d1jrhi_ appears in the current release, SCOPe 2.08