Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (24 proteins) |
Protein Interferon-gamma receptor alpha chain [49293] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries) |
Domain d1jrhi_: 1jrh I: [22059] Other proteins in same PDB: d1jrhh1, d1jrhh2, d1jrhl1, d1jrhl2 N-terminal domain |
PDB Entry: 1jrh (more details), 2.8 Å
SCOP Domain Sequences for d1jrhi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrhi_ b.1.2.1 (I:) Interferon-gamma receptor alpha chain {Human (Homo sapiens)} svptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycni sdhvgdpsnslwvrvkarvgqkesayakseefavs
Timeline for d1jrhi_:
View in 3D Domains from other chains: (mouse over for more information) d1jrhh1, d1jrhh2, d1jrhl1, d1jrhl2 |