Lineage for d1jrhi_ (1jrh I:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290647Protein Interferon-gamma receptor alpha chain [49293] (1 species)
  7. 290648Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
  8. 290653Domain d1jrhi_: 1jrh I: [22059]
    Other proteins in same PDB: d1jrhh1, d1jrhh2, d1jrhl1, d1jrhl2
    N-terminal domain
    mutant

Details for d1jrhi_

PDB Entry: 1jrh (more details), 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrhi_ b.1.2.1 (I:) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
svptptnvtiesynmnpivyweyqimpqvpvftvevknygvknsewidacinishhycni
sdhvgdpsnslwvrvkarvgqkesayakseefavs

SCOP Domain Coordinates for d1jrhi_:

Click to download the PDB-style file with coordinates for d1jrhi_.
(The format of our PDB-style files is described here.)

Timeline for d1jrhi_: