Lineage for d4ejob1 (4ejo B:1-115)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984273Species Eggerthella lenta [TaxId:479437] [226359] (2 PDB entries)
  8. 1984275Domain d4ejob1: 4ejo B:1-115 [220587]
    Other proteins in same PDB: d4ejoa2, d4ejob2
    automated match to d1xmab_
    complexed with eoh

Details for d4ejob1

PDB Entry: 4ejo (more details), 2.1 Å

PDB Description: Crystal structure of padr family transcriptional regulator from Eggerthella lenta DSM 2243
PDB Compounds: (B:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d4ejob1:

Sequence, based on SEQRES records: (download)

>d4ejob1 a.4.5.0 (B:1-115) automated matches {Eggerthella lenta [TaxId: 479437]}
mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrle
sqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletngedr

Sequence, based on observed residues (ATOM records): (download)

>d4ejob1 a.4.5.0 (B:1-115) automated matches {Eggerthella lenta [TaxId: 479437]}
mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipitlyplmrrlesqg
llasewdnggkprkyyrttdeglrvlreveaqwhvlcdgvgklletngedr

SCOPe Domain Coordinates for d4ejob1:

Click to download the PDB-style file with coordinates for d4ejob1.
(The format of our PDB-style files is described here.)

Timeline for d4ejob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ejob2