![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Eggerthella lenta [TaxId:479437] [226359] (2 PDB entries) |
![]() | Domain d4ejob1: 4ejo B:1-115 [220587] Other proteins in same PDB: d4ejoa2, d4ejob2 automated match to d1xmab_ complexed with eoh |
PDB Entry: 4ejo (more details), 2.1 Å
SCOPe Domain Sequences for d4ejob1:
Sequence, based on SEQRES records: (download)
>d4ejob1 a.4.5.0 (B:1-115) automated matches {Eggerthella lenta [TaxId: 479437]} mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrle sqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletngedr
>d4ejob1 a.4.5.0 (B:1-115) automated matches {Eggerthella lenta [TaxId: 479437]} mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipitlyplmrrlesqg llasewdnggkprkyyrttdeglrvlreveaqwhvlcdgvgklletngedr
Timeline for d4ejob1: