SCOPe 2.06: Domain d4ejoa1: 4ejo A:1-111

Lineage for d4ejoa1 (4ejo A:1-111)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Eggerthella lenta [TaxId:479437] [226359] (2 PDB entries)

8. Domain d4ejoa1: 4ejo A:1-111 [220586]
   Other proteins in same PDB: d4ejoa2, d4ejob2
   automated match to d1xmab_
   complexed with eoh

Details for d4ejoa1

PDB Entry: 4ejo, 2.1 Å

PDB Description: Crystal structure of padr family transcriptional regulator from Eggerthella lenta DSM 2243

PDB Compounds: (A:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d4ejoa1:

Sequence; same for both SEQRES and ATOM records:

>d4ejoa1 a.4.5.0 (A:1-111) automated matches {Eggerthella lenta [TaxId: 479437]}
mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrle
sqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletn

Timeline for d4ejoa1:

• d4ejoa1 first appeared in SCOPe 2.03, called d4ejoa_
  
• d4ejoa1 was called d4ejoa_ in SCOPe 2.05
  
• d4ejoa1 appears in SCOPe 2.07
  
• d4ejoa1 appears in the current release, SCOPe 2.08