Lineage for d4ejoa1 (4ejo A:1-111)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694687Species Eggerthella lenta [TaxId:479437] [226359] (2 PDB entries)
  8. 2694688Domain d4ejoa1: 4ejo A:1-111 [220586]
    Other proteins in same PDB: d4ejoa2, d4ejob2
    automated match to d1xmab_
    complexed with eoh

Details for d4ejoa1

PDB Entry: 4ejo (more details), 2.1 Å

PDB Description: Crystal structure of padr family transcriptional regulator from Eggerthella lenta DSM 2243
PDB Compounds: (A:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d4ejoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ejoa1 a.4.5.0 (A:1-111) automated matches {Eggerthella lenta [TaxId: 479437]}
mayddivssmvlelrrgtlvmlvlsqlrepaygyalvksladhgipieantlyplmrrle
sqgllasewdnggskprkyyrttdeglrvlreveaqwhvlcdgvgklletn

SCOPe Domain Coordinates for d4ejoa1:

Click to download the PDB-style file with coordinates for d4ejoa1.
(The format of our PDB-style files is described here.)

Timeline for d4ejoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ejoa2