SCOP 1.55: Domain d1fyhe2: 1fyh E:110-222

Lineage for d1fyhe2 (1fyh E:110-222)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (14 proteins)

6. Protein Interferon-gamma receptor alpha chain [49293] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [49294] (3 PDB entries)
8. Domain d1fyhe2: 1fyh E:110-222 [22058]
   Other proteins in same PDB: d1fyha1, d1fyha2, d1fyhd1, d1fyhd2

Details for d1fyhe2

PDB Entry: 1fyh, 2.04 Å

PDB Description: 1:1 complex between an interferon gamma single-chain variant and its receptor

SCOP Domain Sequences for d1fyhe2:

Sequence, based on SEQRES records:

>d1fyhe2 b.1.2.1 (E:110-222) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpsvfvngdeqevdydpettcyirvynvyvrmngseiqyk
iltqkeddcdeiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitif

Sequence, based on observed residues (ATOM records):

>d1fyhe2 b.1.2.1 (E:110-222) Interferon-gamma receptor alpha chain {Human (Homo sapiens)}
igppkldirkeekqimidifhpsvfvpettcyirvynvyvrmngseiqykiltqkeddcd
eiqcqlaipvsslnsqycvsaegvlhvwgvttekskevcitif

SCOP Domain Coordinates for d1fyhe2 are not available.

Timeline for d1fyhe2:

• d1fyhe2 appears in SCOP 1.57
  
• d1fyhe2 appears in the current release, SCOPe 2.08