Lineage for d4ejhg_ (4ejh G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005639Domain d4ejhg_: 4ejh G: [220579]
    automated match to d1dt6a_
    complexed with 0qa, gol, hem

Details for d4ejhg_

PDB Entry: 4ejh (more details), 2.35 Å

PDB Description: human cytochrome p450 2a13 in complex with 4-(methylnitrosamino)-1-(3- pyridyl)-1-butanone (nnk)
PDB Compounds: (G:) Cytochrome P450 2A13

SCOPe Domain Sequences for d4ejhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ejhg_ a.104.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkeal
vdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriqe
eagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfqf
tatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfidsf
lirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvheei
drvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgtev
fpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelfl
ffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d4ejhg_:

Click to download the PDB-style file with coordinates for d4ejhg_.
(The format of our PDB-style files is described here.)

Timeline for d4ejhg_: