Lineage for d4ejge_ (4ejg E:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278021Species Human (Homo sapiens) [TaxId:9606] [196470] (23 PDB entries)
  8. 1278097Domain d4ejge_: 4ejg E: [220569]
    automated match to d1dt6a_
    complexed with gol, hem, nct

Details for d4ejge_

PDB Entry: 4ejg (more details), 2.5 Å

PDB Description: human cytochrome p450 2a13 in complex with nicotine
PDB Compounds: (E:) Cytochrome P450 2A13

SCOPe Domain Sequences for d4ejge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ejge_ a.104.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavke
alvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeri
qeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsf
qftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfid
sflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhe
eidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgt
evfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmel
flffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr

SCOPe Domain Coordinates for d4ejge_:

Click to download the PDB-style file with coordinates for d4ejge_.
(The format of our PDB-style files is described here.)

Timeline for d4ejge_: