SCOPe 2.07: Domain d4ei6d2: 4ei6 D:116-243

Lineage for d4ei6d2 (4ei6 D:116-243)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4ei6d2: 4ei6 D:116-243 [220561]
   Other proteins in same PDB: d4ei6a1, d4ei6b1, d4ei6c1, d4ei6d1
   automated match to d1ktke2

Details for d4ei6d2

PDB Entry: 4ei6, 1.6 Å

PDB Description: Structure of XV19 Valpha1-Vbeta16 Type-II Natural Killer T cell receptor

PDB Compounds: (D:) Vbeta16 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei6d2:

Sequence; same for both SEQRES and ATOM records:

>d4ei6d2 b.1.1.2 (D:116-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4ei6d2:

• d4ei6d2 first appeared in SCOPe 2.03
  
• d4ei6d2 appears in SCOPe 2.06
  
• d4ei6d2 appears in the current release, SCOPe 2.08