Lineage for d4ei6d1 (4ei6 D:3-115)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520502Domain d4ei6d1: 4ei6 D:3-115 [220560]
    Other proteins in same PDB: d4ei6a2, d4ei6b2, d4ei6c2, d4ei6d2
    automated match to d1ktke1

Details for d4ei6d1

PDB Entry: 4ei6 (more details), 1.6 Å

PDB Description: Structure of XV19 Valpha1-Vbeta16 Type-II Natural Killer T cell receptor
PDB Compounds: (D:) Vbeta16 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei6d1 b.1.1.0 (D:3-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksklfk
dqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvle

SCOPe Domain Coordinates for d4ei6d1:

Click to download the PDB-style file with coordinates for d4ei6d1.
(The format of our PDB-style files is described here.)

Timeline for d4ei6d1: