Lineage for d4ei6c2 (4ei6 C:115-202)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2363651Domain d4ei6c2: 4ei6 C:115-202 [220559]
    Other proteins in same PDB: d4ei6a1, d4ei6b1, d4ei6c1, d4ei6d1
    automated match to d2f54d2

Details for d4ei6c2

PDB Entry: 4ei6 (more details), 1.6 Å

PDB Description: Structure of XV19 Valpha1-Vbeta16 Type-II Natural Killer T cell receptor
PDB Compounds: (C:) Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei6c2:

Sequence, based on SEQRES records: (download)

>d4ei6c2 b.1.1.2 (C:115-202) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4ei6c2 b.1.1.2 (C:115-202) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ipdpavyqlrdssvclftdfdsqtnvsqssdvyitdkcvldmrsmdfksnsavawsnfac
anafnnsiipedtffp

SCOPe Domain Coordinates for d4ei6c2:

Click to download the PDB-style file with coordinates for d4ei6c2.
(The format of our PDB-style files is described here.)

Timeline for d4ei6c2: