Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d4ei6c1: 4ei6 C:2-114 [220558] Other proteins in same PDB: d4ei6a2, d4ei6b2, d4ei6c2, d4ei6d2 automated match to d2f54d1 |
PDB Entry: 4ei6 (more details), 1.6 Å
SCOPe Domain Sequences for d4ei6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei6c1 b.1.1.0 (C:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qkvqqspeslsvpeggmaslnctssdrnfqyfwwyrqhsgegpkalmsifsdgdkkegrf tahlnkaslhvslhirdsqpsdsalyfcaaseqnnyaqgltfglgtrvsvfpy
Timeline for d4ei6c1: