![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (628 PDB entries) |
![]() | Domain d4ei6a2: 4ei6 A:115-203 [220555] Other proteins in same PDB: d4ei6a1, d4ei6b1, d4ei6c1, d4ei6d1 automated match to d2f54d2 |
PDB Entry: 4ei6 (more details), 1.6 Å
SCOPe Domain Sequences for d4ei6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei6a2 b.1.1.2 (A:115-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d4ei6a2: