Lineage for d1cto__ (1cto -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) 
Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries) 
Domain d1cto__: 1cto - [22054]
Details for d1cto__
PDB Entry: 1cto (more details)
PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure
SCOP Domain Sequences for d1cto__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cto__ b.1.2.1 (-) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk
SCOP Domain Coordinates for d1cto__:
Click to download the PDB-style file with coordinates for d1cto__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cto__:
- d1cto__ first appeared (with stable ids) in SCOP 1.55
- d1cto__ appears in SCOP 1.57
- d1cto__ appears in SCOP 1.61
- d1cto__ appears in the current release, SCOPe 2.08, called d1ctoa_
View in 3D