Lineage for d1cto__ (1cto -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54816Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species)
  7. 54817Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 54831Domain d1cto__: 1cto - [22054]

Details for d1cto__

PDB Entry: 1cto (more details)

PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure

SCOP Domain Sequences for d1cto__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cto__ b.1.2.1 (-) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk

SCOP Domain Coordinates for d1cto__:

Click to download the PDB-style file with coordinates for d1cto__.
(The format of our PDB-style files is described here.)

Timeline for d1cto__: