SCOPe 2.08: Domain d1ctoa_: 1cto A:

Lineage for d1ctoa_ (1cto A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)

8. Domain d1ctoa_: 1cto A: [22054]
   2nd domain

Details for d1ctoa_

PDB Entry: 1cto

PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure

PDB Compounds: (A:) granulocyte colony-stimulating factor receptor

SCOPe Domain Sequences for d1ctoa_:

Sequence; same for both SEQRES and ATOM records:

>d1ctoa_ b.1.2.1 (A:) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk

Timeline for d1ctoa_:

• d1ctoa_ first appeared (with stable ids) in SCOP 1.55, called d1cto__
  
• d1ctoa_ appears in SCOPe 2.07