Lineage for d1ctoa_ (1cto A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761903Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)
  7. 2761907Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 2761921Domain d1ctoa_: 1cto A: [22054]
    2nd domain

Details for d1ctoa_

PDB Entry: 1cto (more details)

PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, minimized average structure
PDB Compounds: (A:) granulocyte colony-stimulating factor receptor

SCOPe Domain Sequences for d1ctoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctoa_ b.1.2.1 (A:) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk

SCOPe Domain Coordinates for d1ctoa_:

Click to download the PDB-style file with coordinates for d1ctoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ctoa_: