SCOPe 2.08: Domain d4eh1b2: 4eh1 B:111-239

Lineage for d4eh1b2 (4eh1 B:111-239)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226358] (1 PDB entry)

8. Domain d4eh1b2: 4eh1 B:111-239 [220539]
   Other proteins in same PDB: d4eh1a1, d4eh1b1
   automated match to d1gvha3
   complexed with cl, fad, gol, so4

Details for d4eh1b2

PDB Entry: 4eh1, 2.2 Å

PDB Description: Crystal Structure of the Flavohem-like-FAD/NAD Binding Domain of Nitric Oxide Dioxygenase from Vibrio cholerae O1 biovar El Tor

PDB Compounds: (B:) flavohemoprotein

SCOPe Domain Sequences for d4eh1b2:

Sequence; same for both SEQRES and ATOM records:

>d4eh1b2 c.25.1.0 (B:111-239) automated matches {Vibrio cholerae [TaxId: 243277]}
yvererpvvlisagvgatpmqailhtlakqnksgvtylyacnsakehtfaqetaqliaqq
gwmqqvwyrdesaddvlqgemqlaelilpiedgdfylcgpigfmqyvvkqllalgvdkar
ihyevfgph

Timeline for d4eh1b2:

• d4eh1b2 first appeared in SCOPe 2.03
  
• d4eh1b2 appears in SCOPe 2.07