SCOPe 2.08: Domain d4eh1b1: 4eh1 B:3-110

Lineage for d4eh1b1 (4eh1 B:3-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226357] (1 PDB entry)

8. Domain d4eh1b1: 4eh1 B:3-110 [220538]
   Other proteins in same PDB: d4eh1a2, d4eh1b2
   automated match to d1gvha2
   complexed with cl, fad, gol, so4

Details for d4eh1b1

PDB Entry: 4eh1, 2.2 Å

PDB Description: Crystal Structure of the Flavohem-like-FAD/NAD Binding Domain of Nitric Oxide Dioxygenase from Vibrio cholerae O1 biovar El Tor

PDB Compounds: (B:) flavohemoprotein

SCOPe Domain Sequences for d4eh1b1:

Sequence; same for both SEQRES and ATOM records:

>d4eh1b1 b.43.4.0 (B:3-110) automated matches {Vibrio cholerae [TaxId: 243277]}
dgrtfvvrekqvesayvtsfvlvpadggavldyqpgqyigievtpegsdyreirqyslsh
asngreyrisvkregvgsdnpglvshylhnnvkvgdsvklyapagdff

Timeline for d4eh1b1:

• d4eh1b1 first appeared in SCOPe 2.03
  
• d4eh1b1 appears in SCOPe 2.07