Lineage for d4egsb_ (4egs B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851592Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1851593Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 1851651Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 1851652Protein automated matches [190574] (15 species)
    not a true protein
  7. 1851705Species Thermoanaerobacter tengcongensis [TaxId:273068] [226489] (1 PDB entry)
  8. 1851707Domain d4egsb_: 4egs B: [220535]
    automated match to d1d1pa_
    complexed with bct, na

Details for d4egsb_

PDB Entry: 4egs (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of Low Molecular Weight Protein Tyrosine Phosphatase from T. tengcongensis
PDB Compounds: (B:) Ribose 5-phosphate isomerase RpiB

SCOPe Domain Sequences for d4egsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egsb_ c.44.1.0 (B:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
smrvlfvctgntcrspmaegifnakskalgkdweaksagvfapegfpasseavevlkkey
gidisdhrakslreedlkgadlvlamafshkrslvsqypeyadkiftikefvglegdved
pygmplevykktaeelsglidkliekl

SCOPe Domain Coordinates for d4egsb_:

Click to download the PDB-style file with coordinates for d4egsb_.
(The format of our PDB-style files is described here.)

Timeline for d4egsb_: