SCOPe 2.08: Domain d4egsb1: 4egs B:1-146

Lineage for d4egsb1 (4egs B:1-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (20 species)
   not a true protein

7. Species Thermoanaerobacter tengcongensis [TaxId:273068] [226489] (1 PDB entry)

8. Domain d4egsb1: 4egs B:1-146 [220535]
   Other proteins in same PDB: d4egsa2, d4egsb2
   automated match to d1d1pa_
   complexed with bct, na

Details for d4egsb1

PDB Entry: 4egs, 2.3 Å

PDB Description: Crystal Structure Analysis of Low Molecular Weight Protein Tyrosine Phosphatase from T. tengcongensis

PDB Compounds: (B:) Ribose 5-phosphate isomerase RpiB

SCOPe Domain Sequences for d4egsb1:

Sequence; same for both SEQRES and ATOM records:

>d4egsb1 c.44.1.0 (B:1-146) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mrvlfvctgntcrspmaegifnakskalgkdweaksagvfapegfpasseavevlkkeyg
idisdhrakslreedlkgadlvlamafshkrslvsqypeyadkiftikefvglegdvedp
ygmplevykktaeelsglidkliekl

Timeline for d4egsb1:

• d4egsb1 first appeared in SCOPe 2.03, called d4egsb_
  
• d4egsb1 appears in SCOPe 2.07