Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (27 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [226352] (1 PDB entry) |
Domain d4egqd2: 4egq D:103-311 [220533] Other proteins in same PDB: d4egqa1, d4egqb1, d4egqc1, d4egqd1 automated match to d1e4ea2 |
PDB Entry: 4egq (more details), 2.2 Å
SCOPe Domain Sequences for d4egqd2:
Sequence, based on SEQRES records: (download)
>d4egqd2 d.142.1.0 (D:103-311) automated matches {Burkholderia pseudomallei [TaxId: 320372]} dkfrtklvwqqtgiptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvk sadalpaaleeaakhdkiviveksiegggeytaciaadldlplirivpagefydyhakyi andtqylipcgldaakeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgm tdhslppkaaravgigyselvvkvlsltl
>d4egqd2 d.142.1.0 (D:103-311) automated matches {Burkholderia pseudomallei [TaxId: 320372]} dkfrtklvwqqtgiptppfetvmrdyaaraqdivaklgvplfvkpalpaaleeaakhdki viveksiegggeytaciaadldlplirivpagefydyhakyianqylipcgldaakeaef kriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigysel vvkvlsltl
Timeline for d4egqd2: