SCOPe 2.08: Domain d4egqd2: 4egq D:103-311

Lineage for d4egqd2 (4egq D:103-311)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [226352] (3 PDB entries)

8. Domain d4egqd2: 4egq D:103-311 [220533]
   Other proteins in same PDB: d4egqa1, d4egqb1, d4egqc1, d4egqd1
   automated match to d1e4ea2

Details for d4egqd2

PDB Entry: 4egq, 2.2 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei

PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egqd2:

Sequence, based on SEQRES records:

>d4egqd2 d.142.1.0 (D:103-311) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dkfrtklvwqqtgiptppfetvmrgddyaaraqdivaklgvplfvkpasegssvavekvk
sadalpaaleeaakhdkiviveksiegggeytaciaadldlplirivpagefydyhakyi
andtqylipcgldaakeaefkriarrafdvlgctdwgradfmldaagnpyflevntapgm
tdhslppkaaravgigyselvvkvlsltl

Sequence, based on observed residues (ATOM records):

>d4egqd2 d.142.1.0 (D:103-311) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dkfrtklvwqqtgiptppfetvmrdyaaraqdivaklgvplfvkpalpaaleeaakhdki
viveksiegggeytaciaadldlplirivpagefydyhakyianqylipcgldaakeaef
kriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigysel
vvkvlsltl

Timeline for d4egqd2:

• d4egqd2 first appeared in SCOPe 2.03
  
• d4egqd2 appears in SCOPe 2.07