SCOP 1.63: Domain d1gcf__: 1gcf -

Lineage for d1gcf__ (1gcf -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (18 proteins)

6. Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)

8. Domain d1gcf__: 1gcf - [22053]
   2nd domain
   mutant

Details for d1gcf__

PDB Entry: 1gcf

PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, 12 structures

SCOP Domain Sequences for d1gcf__:

Sequence; same for both SEQRES and ATOM records:

>d1gcf__ b.1.2.1 (-) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk

Timeline for d1gcf__:

• d1gcf__ first appeared (with stable ids) in SCOP 1.55
  
• d1gcf__ appears in SCOP 1.61
  
• d1gcf__ appears in SCOP 1.65
  
• d1gcf__ appears in the current release, SCOPe 2.08, called d1gcfa_