![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (18 proteins) |
![]() | Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries) |
![]() | Domain d1gcf__: 1gcf - [22053] 2nd domain mutant |
PDB Entry: 1gcf (more details)
SCOP Domain Sequences for d1gcf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcf__ b.1.2.1 (-) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)} gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk
Timeline for d1gcf__: