Lineage for d1gcf__ (1gcf -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) 
Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries) 
Domain d1gcf__: 1gcf - [22053]
Details for d1gcf__
PDB Entry: 1gcf (more details)
PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, 12 structures
SCOP Domain Sequences for d1gcf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcf__ b.1.2.1 (-) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus)}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk
SCOP Domain Coordinates for d1gcf__:
Click to download the PDB-style file with coordinates for d1gcf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gcf__:
- d1gcf__ first appeared (with stable ids) in SCOP 1.55
- d1gcf__ appears in SCOP 1.57
- d1gcf__ appears in SCOP 1.61
- d1gcf__ appears in the current release, SCOPe 2.08, called d1gcfa_
View in 3D