Lineage for d4egqb1 (4egq B:5-102)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1843027Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1843028Protein automated matches [226903] (28 species)
    not a true protein
  7. 1843037Species Burkholderia pseudomallei [TaxId:320372] [226351] (1 PDB entry)
  8. 1843039Domain d4egqb1: 4egq B:5-102 [220528]
    Other proteins in same PDB: d4egqa2, d4egqb2, d4egqc2, d4egqd2
    automated match to d1e4ea1

Details for d4egqb1

PDB Entry: 4egq (more details), 2.2 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egqb1 c.30.1.0 (B:5-102) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegfvr
afnalhggygengqiqgaldfygirytgsgvlgsalgl

SCOPe Domain Coordinates for d4egqb1:

Click to download the PDB-style file with coordinates for d4egqb1.
(The format of our PDB-style files is described here.)

Timeline for d4egqb1: