Lineage for d4egod_ (4ego D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1499255Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1499256Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1499814Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1499815Protein automated matches [190847] (40 species)
    not a true protein
  7. 1500071Species Rhodopseudomonas palustris [TaxId:316058] [193594] (6 PDB entries)
  8. 1500075Domain d4egod_: 4ego D: [220525]
    automated match to d4do1d_
    complexed with 1f1, cl, gol, hem, so4

Details for d4egod_

PDB Entry: 4ego (more details), 1.76 Å

PDB Description: The X-ray crystal structure of CYP199A4 in complex with indole-6-carboxylic acid
PDB Compounds: (D:) cytochrome p450

SCOPe Domain Sequences for d4egod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egod_ a.104.1.0 (D:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d4egod_:

Click to download the PDB-style file with coordinates for d4egod_.
(The format of our PDB-style files is described here.)

Timeline for d4egod_: