SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4egnc_ (4egn C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (54 species)
    not a true protein
  7. 2005837Species Rhodopseudomonas palustris [TaxId:316058] [193594] (6 PDB entries)
  8. 2005848Domain d4egnc_: 4egn C: [220520]
    automated match to d4do1d_
    complexed with cl, gol, hem, so4, two

Details for d4egnc_

PDB Entry: 4egn (more details), 2 Å

PDB Description: The X-ray crystal structure of CYP199A4 in complex with veratric acid
PDB Compounds: (C:) cytochrome p450

SCOPe Domain Sequences for d4egnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egnc_ a.104.1.0 (C:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d4egnc_:

Click to download the PDB-style file with coordinates for d4egnc_.
(The format of our PDB-style files is described here.)

Timeline for d4egnc_: