Lineage for d4egma_ (4egm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005837Species Rhodopseudomonas palustris [TaxId:316058] [193594] (6 PDB entries)
  8. 2005854Domain d4egma_: 4egm A: [220514]
    automated match to d4do1d_
    complexed with cl, egm, gol, hem, so4

Details for d4egma_

PDB Entry: 4egm (more details), 2.91 Å

PDB Description: The X-ray crystal structure of CYP199A4 in complex with 4-ethylbenzoic acid
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d4egma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egma_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d4egma_:

Click to download the PDB-style file with coordinates for d4egma_.
(The format of our PDB-style files is described here.)

Timeline for d4egma_: