![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:316058] [193594] (35 PDB entries) |
![]() | Domain d4egma_: 4egm A: [220514] automated match to d4do1d_ complexed with cl, egm, gol, hem, so4 |
PDB Entry: 4egm (more details), 2.91 Å
SCOPe Domain Sequences for d4egma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4egma_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]} tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala rkvaaididgpvkrrfnntlrgleslpvkltpa
Timeline for d4egma_: