Lineage for d4egjb1 (4egj B:4-102)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862374Species Burkholderia xenovorans [TaxId:266265] [226415] (1 PDB entry)
  8. 2862376Domain d4egjb1: 4egj B:4-102 [220508]
    Other proteins in same PDB: d4egja2, d4egjb2, d4egjc2, d4egjd2
    automated match to d1e4ea1

Details for d4egjb1

PDB Entry: 4egj (more details), 2.3 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4egjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egjb1 c.30.1.0 (B:4-102) automated matches {Burkholderia xenovorans [TaxId: 266265]}
idpkqfgkvavllggnsaerevslnsgrlvlqglrdagidahpfdpaerplaalkeegfv
rafnalhggygengqiqgaldfygirytgsgvlgsalgl

SCOPe Domain Coordinates for d4egjb1:

Click to download the PDB-style file with coordinates for d4egjb1.
(The format of our PDB-style files is described here.)

Timeline for d4egjb1: