SCOPe 2.08: Domain d4egfh_: 4egf H:

Lineage for d4egfh_ (4egf H:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189539] (12 PDB entries)

8. Domain d4egfh_: 4egf H: [220505]
   automated match to d3pk0b_

Details for d4egfh_

PDB Entry: 4egf, 2.3 Å

PDB Description: crystal structure of a l-xylulose reductase from mycobacterium smegmatis

PDB Compounds: (H:) L-xylulose reductase

SCOPe Domain Sequences for d4egfh_:

Sequence; same for both SEQRES and ATOM records:

>d4egfh_ c.2.1.0 (H:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dryagvlrldgkralitgatkgigadiarafaaagarlvlsgrdvseldaarralgeqfg
tdvhtvaidlaepdapaelarraaeafggldvlvnnagishpqpvvdtdpqlfdatiavn
lrapallasavgkamvaageggaiitvasaaalaplpdhyayctskaglvmatkvlarel
gphgiransvcptvvltemgqrvwgdeaksapmiariplgrfavphevsdavvwlasdaa
smingvdipvdggytmg

Timeline for d4egfh_:

• d4egfh_ first appeared in SCOPe 2.03
  
• d4egfh_ appears in SCOPe 2.07